Recombinant Proteins

Modified or manipulated proteins encoded by recombinant DNA and suitable for a variety of purposes including the modification of gene sequences, mass protein production, and the manufacture of commercial products.

Search Within Results

2,926 – 2,940 of 127,599 results

2,926

Novus Biologicals™ Recombinant Human OATP1B1/OATP2 GST (N-Term) Protein

Recombinant Protein

Pricing & Availability
Specifications

Purity or Quality Grade	>80% by SDS-PAGE and Coomassie blue staining
Gene Alias	Liver-specific organic anion transporter 1, LST1SLC21A6, LST-1Solute carrier family 21 member 6, OATP1B1Sodium-independent organic anion-transporting polypeptide 2, OATP2MGC133282, OATP-COATP-2, OATPCsolute carrier organic anion transporter family member 1B1, solute carrier family 21 (organic anion transporter), member 6, solute carrier organic anion transporter family, member 1B1
Molecular Weight (g/mol)	35.64 kDa
Gene ID (Entrez)	10599
Formulation	50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Gene Symbol	SLCO1B1
Research Category	Membrane Trafficking and Chaperones
Storage Requirements	Store at -80°C. Avoid freeze-thaw cycles.
For Use With (Application)	Western Blot,ELISA,Protein Array,Immunoaffinity Purification
Protein	OATP1B1/OATP2

2,927

Novus Biologicals™ PSMA4 Protein

Highly purified. Generating reliable and reproducible results.

Pricing & Availability
Specifications

Accession Number	NP_001096137
Regulatory Status	RUO
Purification Method	SDS-PAGE
Purity or Quality Grade	>95%
Conjugate	Unconjugated
Common Name	PSMA4
Gene ID (Entrez)	5685
Storage Requirements	Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
For Use With (Application)	SDS-PAGE
Source	Human

2,928

R&D Systems™ Recombinant Human Cadherin-20 (CAD-20) Protein

Extensive quality control produces industry leading bioactivity and lot-to-lot consistency that instills confidence in results and ensures reproducibility.

Pricing & Availability

2,929

Novus Biologicals™ Recombinant Human alpha Endosulfine His Protein

Highly purified. Generating reliable and reproducible results.

Pricing & Availability

2,930

R&D Systems™ Recombinant Mouse Noggin (aa 28-232) Protein

Measured by its ability to inhibit BMP-4-induced alkaline phosphatase production by ATDC5 mouse chondrogenic cells. The ED50 for this effect is 0.04 to 0.16 μg/mL in the presence of 50 ng/mL of Recombinant Human BMP-4.

Pricing & Availability

2,931

Novus Biologicals™ Mycobacterium Tuberculosis ESAT6 Protein

Highly purified. Generating reliable and reproducible results. Applications: SDS-Page

Pricing & Availability

2,932

Novus Biologicals™ Recombinant Mouse Cathepsin S His Protein

Highly purified. Generating reliable and reproducible results. Applications: SDS-Page

Pricing & Availability
Specifications

Purity or Quality Grade	>90%, by SDS-PAGE under reducing conditions and visualized by Colloidal Coomassie™ Blue stain
Conjugate	Unconjugated
Gene Alias	cathepsin S, EC 3.4.22, EC 3.4.22.27, FLJ50259, MGC3886
Common Name	Cathepsin S
Molecular Weight (g/mol)	TMW: 37.2kDa
Gene ID (Entrez)	1520
Formulation	Phosphate buffered saline (pH 7.4) containing 10% glycerol
Storage Requirements	Store at 4°C short term. Aliquot and store at −20°C long term. Avoid freeze-thaw cycles.
Concentration	0.5mg/mL
For Use With (Application)	SDS-PAGE
Source	Baculovirus
Recombinant	Recombinant

2,933

Gibco™ Rat MIP-1 beta (CCL4) Recombinant Protein, PeproTech®

Recombinant Protein

Pricing & Availability
Specifications

Content And Storage	-20°C
Purity or Quality Grade	≥ 98% by SDS-PAGE gel and HPLC analyses.
Conjugate	Unconjugated
Form	Lyophilized
Common Name	CCL4
Molecular Weight (g/mol)	7.8 kDa
Gene Symbol	CCL4
Endotoxin Concentration	<1 EU/μg
Sequence	APIGSDPPTS CCFSYTSRKI HRNFVMDYYE TSSLCSQPAV VFLTKKGRQI CADPSEPWVN EYVNDLELN
Expression System	E. coli
For Use With (Application)	Control,Bioactivity
Source	E. coli
Name	Rat MIP-1 beta (CCL4)
Accession Number	P50230
Gene Alias	ACT2; ACT-2; AT744.1; CC chemokine ligand 4; C-C motif chemokine 4; C-C motif chemokine ligand 4; Ccl4; chemokine (C-C motif) ligand 4; G-26; G-26 T-lymphocyte-secreted protein; HC21; immune activation gene 2; immune activation gene-2; immune activation protein 2; LAG1; LAG-1; Lymphocyte activation gene 1 protein; macrophage inflammatory protein 1-beta; macrophage inflammatory protein-1 beta; MGC104418; MGC126025; MGC126026; MIP-1 beta; MIP1b; MIP-1B; Mip1-b; MIP1B1; MIP1beta; MIP-1BETA; MIP-1-beta; MIP1-beta; MIP-1-beta(1-69); MIP-1-beta(3-69); PAT 744; Protein H400; putative MIP-1beta protein; RP23-320E6.8; SCY4A; SCYA2; Scya4; secreted protein G-26; SIS-gamma; small inducible cytokine A4; small inducible cytokine A4 (homologous to mouse Mip-1b); small-inducible cytokine A4; T-cell activation protein 2
Biological Activity	Determined by its ability to chemoattract human monocytes using a concentration range of 0.01-1.0 ug/ml
Gene ID (Entrez)	116637
Formulation	Protein with no preservative
Recombinant	Recombinant

2,934

Gibco™ Human GITR/TNFRSF18 Fc Recombinant Protein, PeproTech®

Recombinant Protein

Pricing & Availability
Specifications

Content And Storage	-20°C
Purity or Quality Grade	≥ 95% by SDS-PAGE gel and HPLC analyses.
Conjugate	Unconjugated
Form	Lyophilized
Common Name	GITR
Molecular Weight (g/mol)	40.6 kDa
Gene Symbol	Tnfrsf18
Endotoxin Concentration	<1 EU/μg
Sequence	QRPTGGPGCG PGRLLLGTGT DARCCRVHTT RCCRDYPGEE CCSEWDCMCV QPEFHCGDPC CTTCRHHPCP PGQGVQSQGK FSFGFQCIDC ASGTFSGGHE GHCKPWTDCT QFGFLTVFPG NKTHNAVCVP GSPPAEGGPK SCDKTHTCPP CPAPELLGGP SVFLFPPKPK DTLMISRTPE VTCVVVDVSH EDPEVKFNWY VDGVEVHNAK TKPREEQYNS TYRVVSVLTV LHQDWLNGKE YKCKVSNKAL PAPIEKTISK AKGQPREPQV YTLPPSRDEL TKNQVSLTCL VKGFYPSDIA VEWESNGQPE NNYKTTPPVL DSDGSFFLYS KLTVDKSRWQ QGNVFSCSVM HEALHNHYTQ KSLSLSPGK
Expression System	CHO cells
For Use With (Application)	Control,ELISA Standard,Binding Assay
Source	CHO cells
Name	Human GITR/TNFRSF18 Fc
Accession Number	Q9Y5U5
Gene Alias	Activation-inducible TNFR family receptor; AITR; CD357; GITR; GITR-D; glucocorticoid-induced TNFR-related protein; PRO364; TNF receptor superfamily activation-inducible protein; TNF receptor superfamily member 18; TNFRSF18; Tumor necrosis factor receptor superfamily member 18; tumor necrosis factor receptor superfamily, member 18; UNQ319; UNQ319/PRO364
Biological Activity	Determined by its ability to bind recombinant human GITR Ligand/TNFSF18 in a functional ELISA.
Gene ID (Entrez)	8784
Formulation	Protein with no preservative
Protein Tag	Fc-tag
Recombinant	Recombinant

2,935

Novus Biologicals™ Recombinant Human TSPAN8/TM4SF3 GST (N-Term) Protein

Recombinant Protein

Pricing & Availability
Specifications

Purity or Quality Grade	>80% by SDS-PAGE and Coomassie blue staining
Gene Alias	CO-029, tetraspanin 8, TM4SF3tspan-8, Transmembrane 4 superfamily member 3tetraspanin-8, Tspan-8, Tumor-associated antigen CO-029
Molecular Weight (g/mol)	36.3 kDa
Gene ID (Entrez)	7103
Formulation	50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Gene Symbol	TSPAN8
Research Category	Cancer
Storage Requirements	Store at -80°C. Avoid freeze-thaw cycles.
For Use With (Application)	Western Blot,ELISA,Protein Array,Immunoaffinity Purification
Protein	TSPAN8/TM4SF3

2,936

Novus Biologicals™ Recombinant Human POLD3 GST (N-Term) Protein

Recombinant Protein

Pricing & Availability
Specifications

Purity or Quality Grade	>80% by SDS-PAGE and Coomassie blue staining
Gene Alias	DNA polymerase delta subunit 3, DNA polymerase delta subunit p66, DNA polymerase delta, subunit 3, KIAA0039MGC119643, MGC119642, P66, P68, polymerase (DNA directed), delta 3, polymerase (DNA-directed), delta 3, accessory subunit
Molecular Weight (g/mol)	37.84 kDa
Gene ID (Entrez)	10714
Formulation	50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Gene Symbol	POLD3
Research Category	Cell Cycle and Replication
Storage Requirements	Store at -80°C. Avoid freeze-thaw cycles.
For Use With (Application)	Western Blot,ELISA,Protein Array,Immunoaffinity Purification
Protein	POLD3

2,937

Novus Biologicals™ Recombinant Human ACTR1B GST (N-Term) Protein

Recombinant Protein

Pricing & Availability
Specifications

Purity or Quality Grade	>80% by SDS-PAGE and Coomassie blue staining
Gene Alias	Actin-related protein 1B, ARP1 (actin-related protein 1, yeast) homolog B (centractin beta), ARP1 actin-related protein 1 homolog B, centractin beta (yeast), ARP1BPC3, centractin beta, CTRN2beta-centractin
Molecular Weight (g/mol)	68.7 kDa
Gene ID (Entrez)	10120
Formulation	50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Gene Symbol	ACTR1B
Research Category	Cell Biology, Cell Cycle and Replication, Cytoskeleton Markers, Signal Transduction
Storage Requirements	Store at -80°C. Avoid freeze-thaw cycles.
For Use With (Application)	Western Blot,ELISA,Protein Array,Immunoaffinity Purification
Protein	ACTR1B

2,938

Novus Biologicals™ Recombinant Human TSSC1 GST (N-Term) Protein

Recombinant Protein

Pricing & Availability
Specifications

Purity or Quality Grade	>80% by SDS-PAGE and Coomassie blue staining
Gene Alias	protein TSSC1, tumor suppressing subtransferable candidate 1, Tumor-suppressing STF cDNA 1 protein, Tumor-suppressing subchromosomal transferable fragment candidate gene 1 protein
Molecular Weight (g/mol)	70 kDa
Gene ID (Entrez)	7260
Formulation	50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Gene Symbol	EIPR1
Storage Requirements	Store at -80°C. Avoid freeze-thaw cycles.
For Use With (Application)	Western Blot,ELISA,Protein Array,Immunoaffinity Purification
Protein	TSSC1

2,939

Promotions Available

R&D Systems™ Recombinant Human CCL4L1/MIP-1 beta Isoform LAG-1 Protein

Extensive quality control produces industry leading bioactivity and lot-to-lot consistency that instills confidence in results and ensures reproducibility. Applications: Bioactivity

Pricing & Availability
Specifications

Purity or Quality Grade	95%, by SDS-PAGE under reducing conditions and visualized by silver stain.
Conjugate	Unconjugated
Molecular Weight (g/mol)	7.8 kDa
Gene ID (Entrez)	9560
Quantity	25 μg
Storage Requirements	Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70° C as supplied. 1 month, 2 to 8° C under sterile conditions after reconstitution. 3 months, -20 to -70° C under sterile conditions after reconstitution.
Source	E. coli-derived human CCL4L1/LAG-1 protein Ala24-Asn92
Recombinant	Recombinant
Name	CCL4L1/LAG-1

2,940

Novus Biologicals™ ANP32A Protein

Highly purified. Generating reliable and reproducible results.

Pricing & Availability
Specifications

Regulatory Status	RUO
Purification Method	Protein
Purity or Quality Grade	>90%
Conjugate	Unconjugated
Common Name	ANP32A
Molecular Weight (g/mol)	30.7kDa
Gene ID (Entrez)	8125
Formulation	Liquid. 20mM Tris-HCl buffer (pH 8.0) containing 10% glycerol, 1mM DTT, 100mM NaCl, 0.1mM PMSF
Immunogen	ANP32A, 1-249aa. Sequence: MGSSHHHHHHSSGLVPRGSHMEMGRRIHLELRNRTPSDVKELVLDNSRSNEGKLEGLTDEFEELEFLSTINVGLTSIANLPKLNKLKKLELSDNRVSGGLEVLAEKCPNLTHLNLSGNKIKDLSTIEPLKKLENLKSLDLFNCEVTNLNDYRENVFKLLPQLTYLDGYDRDDKEAPDSDAEGYVEGLDDEEEDEDEEEYDEDAQVVEDEEDEDEEEEGEEEDVSGEEEEDEEGYNDGEVDDEEDEEELGEEERGQKRKREPEDEGEDDD
Storage Requirements	Store at -80°C. Avoid freeze-thaw cycles.
Concentration	0.5mg/mL
For Use With (Application)	ELISA,SDS-PAGE
Source	Human

Prev
1
...
194
195
196
197
...
8,507
Next

Recombinant Proteins

Filtered Search Results

Narrow Results

Novus Biologicals™ Recombinant Human OATP1B1/OATP2 GST (N-Term) Protein Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Novus Biologicals™ PSMA4 Protein Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

R&D Systems™ Recombinant Human Cadherin-20 (CAD-20) Protein Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Novus Biologicals™ Recombinant Human alpha Endosulfine His Protein Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

R&D Systems™ Recombinant Mouse Noggin (aa 28-232) Protein Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Novus Biologicals™ Mycobacterium Tuberculosis ESAT6 Protein Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Novus Biologicals™ Recombinant Mouse Cathepsin S His Protein Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Novus Biologicals™ Recombinant Human TSPAN8/TM4SF3 GST (N-Term) Protein Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Novus Biologicals™ Recombinant Human POLD3 GST (N-Term) Protein Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Novus Biologicals™ Recombinant Human ACTR1B GST (N-Term) Protein Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Novus Biologicals™ Recombinant Human TSSC1 GST (N-Term) Protein Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

R&D Systems™ Recombinant Human CCL4L1/MIP-1 beta Isoform LAG-1 Protein Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Novus Biologicals™ ANP32A Protein Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Novus Biologicals™ Recombinant Human OATP1B1/OATP2 GST (N-Term) Protein

Novus Biologicals™ PSMA4 Protein

R&D Systems™ Recombinant Human Cadherin-20 (CAD-20) Protein

Novus Biologicals™ Recombinant Human alpha Endosulfine His Protein

R&D Systems™ Recombinant Mouse Noggin (aa 28-232) Protein

Novus Biologicals™ Mycobacterium Tuberculosis ESAT6 Protein

Novus Biologicals™ Recombinant Mouse Cathepsin S His Protein

Novus Biologicals™ Recombinant Human TSPAN8/TM4SF3 GST (N-Term) Protein

Novus Biologicals™ Recombinant Human POLD3 GST (N-Term) Protein

Novus Biologicals™ Recombinant Human ACTR1B GST (N-Term) Protein

Novus Biologicals™ Recombinant Human TSSC1 GST (N-Term) Protein

R&D Systems™ Recombinant Human CCL4L1/MIP-1 beta Isoform LAG-1 Protein

Novus Biologicals™ ANP32A Protein